PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_015860
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family SBP
Protein Properties Length: 303aa    MW: 34484.8 Da    PI: 7.9665
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_015860genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.45.7e-40159236178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cq+ gC+a+l++ak+yhrrhkvCe+hska++v+++g++qrfCqqCsrfh l+efD++krsCr+rLa+hn+rrrk+q+
  DCAR_015860 159 RCQAAGCNANLTHAKHYHRRHKVCEFHSKAATVIAAGMTQRFCQQCSRFHLLTEFDNGKRSCRKRLADHNRRRRKTQQ 236
                  6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.9E-34155221IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.479157234IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.23E-37158237IPR004333Transcription factor, SBP-box
PfamPF031103.9E-30160233IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009556Biological Processmicrosporogenesis
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MLDYEWGNPS SLMVNGDDPP DQDSGHNPQL YNHYTQTFDQ NLLNPNHHNH QNTYENQTHH  60
PYFHYPPTHN THLQSLYDPN SYGSYPDPDP RMMSLDPVHD PTRFMVVPKS EPAGFEYGTS  120
RIGLNLGGRT YFSSSEDDFV NRLYQRSSMV EPGSLNVPRC QAAGCNANLT HAKHYHRRHK  180
VCEFHSKAAT VIAAGMTQRF CQQCSRFHLL TEFDNGKRSC RKRLADHNRR RRKTQQTDQD  240
NKLQLHIASN SSSENLTRSP PDSGVHSSSS VTIAISPPRI SFDKFQQRSD YQASSSSTNS  300
LF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-29152233384squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00090SELEXTransfer from AT1G02065Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012083646.11e-116PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL31e-73SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A067JXX71e-116A0A067JXX7_JATCU; Uncharacterized protein
TrEMBLA0A075FEV51e-116A0A075FEV5_SALMI; SQUAM
STRINGPOPTR_0014s05680.11e-112(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48462341
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.18e-66squamosa promoter binding protein-like 8